2. Signaling Pathways
  3. Metabolic Enzyme/Protease
  4. Angiotensin-converting Enzyme (ACE)

Angiotensin-converting Enzyme (ACE)

Angiotensin-converting Enzyme (ACE)

Related Products

PDF 1.4 MB

Angiotensin-converting enzyme (ACE) indirectly increases blood pressure by causing blood vessels to constrict. ACE does that by converting angiotensin I to angiotensin II, which constricts the vessels. ACE, angiotensin I and angiotensin II are part of the renin-angiotensin system (RAS), which controls blood pressure by regulating the volume of fluids in the body. ACE is secreted in the lungs and kidneys by cells in the endothelium (inner layer) of blood vessels. It has two primary functions: ACE catalyses the conversion of angiotensin I to angiotensin II, a potent vasoconstrictor in a substrate concentration-dependent manner. ACE degrades bradykinin, a potent vasodilator, and other vasoactive peptides. These two actions make ACE inhibition a goal in the treatment of conditions such as high blood pressure, heart failure, diabetic nephropathy, and type 2 diabetes mellitus. Inhibition of ACE (by ACE inhibitors) results in the decreased formation of angiotensin II and decreased metabolism of bradykinin, leading to systematic dilation of the arteries and veins and a decrease in arterial blood pressure.

Cat. No. Product Name Effect Purity Chemical Structure
  • HY-P3985
    Bradykinin potentiator B
    		Inhibitor 99.39%
    Bradykinin potentiator B (Bradykinin potentiating peptide B) is venom of Agkistrodon halys blomhoffi. Bradykinin potentiator B is a potent ACE inhibitor. Bradykinin potentiator inhibits the activity of bradykinin inhibitory peptidase.
    Bradykinin potentiator B
  • HY-123348
    Sampatrilat
    		Inhibitor 99.22%
    Sampatrilat (UK-81252) is a potent and orally active vasopeptidase inhibitor of ACE and neutral endopeptidase (NEP). Sampatrilat inhibits C-domain ACE (Ki=13.8 nM) 12.4-fold more potent than that for the N-domain (Ki=171.9 nM). Sampatrilat (UK-81252) can be used for the study of chronic heart failure and blood pressure regulation.
    Sampatrilat
  • HY-123068
    Captopril disulfide
    		Inhibitor 99.29%
    Captopril disulfide is a metabolite of Captopril with antihypertensive activity.
    Captopril disulfide
  • HY-B0231AS
    Enalaprilat-d5
    		Inhibitor ≥99.0%
    Enalaprilat-d5 is the deuterium labeled Enalaprilat(MK-422), which is an angiotensin-converting enzyme (ACE) inhibitor.
    Enalaprilat-d<sub>5</sub>
  • HY-P10172
    Abz-SDK(Dnp)P-OH
    		99.94%
    Abz-SDK(Dnp)P-OH is a fluorescence peptide. Abz-SDK(Dnp)P-OH is the substrate of angiotensin I-converting enzyme (ACE). Abz-SDK(Dnp)P-OH has fluorescent donor-acceptor pair Abz and Dnp (2,4-dinitrophenyl).
    Abz-SDK(Dnp)P-OH
  • HY-B1451A
    Imidapril
    		Inhibitor ≥99.0%
    Imidapril (TA-6366 free base) is an orally active angiotensin-converting enzyme (ACE) and MMP-9 inhibitor. Imidapril suppresses the conversion of angiotensin I to angiotensin II and thereby reduces total peripheral resistance and systemic blood pressure. Imidapril can be used for hypertension, type 1 diabetic, nephropathy and chronic heart failure research.
    Imidapril
  • HY-108321S
    Zofenopril-d5
    		Inhibitor 99.92%
    Zofenopril-d5 is deuterium labeled Zofenopril. Zofenopril is an angiotensin-converting enzyme (ACE) inhibitor with an IC50 of 81 μM.
    Zofenopril-d<sub>5</sub>
  • HY-137875
    N-Benzoyl-Gly-His-Leu hydrate
    		98.61%
    N-Benzoyl-Gly-His-Leu hydrate is a leucine derivative, a polypeptide. N-Benzoyl-Gly-His-Leu hydrate exerts function with angiotensin converting enzyme (ACE) substrate.
    N-Benzoyl-Gly-His-Leu hydrate
  • HY-U00041
    Pivalopril
    		Inhibitor 99.19%
    Pivalopril is a new orally active angiotensin converting enzyme (ACE) inhibitor.
    Pivalopril
  • HY-P10173
    Abz-LFK(Dnp)-OH
    		98.52%
    Abz-LFK(Dnp)-OH is an angiotensin I-converting enzyme (ACE) peptide substrate. Abz-LFK(Dnp)-OH is selective for the C domain of ACE. Abz-LFK(Dnp)-OH can be used to assess ACE activity.
    Abz-LFK(Dnp)-OH
  • HY-B0331
    Enalapril
    		Inhibitor
    Enalapril (MK-421) is an angiotensin-converting enzyme (ACE) inhibitor, can be used for hypertensive diseases research.
    Enalapril
  • HY-108321
    Zofenopril
    		Inhibitor 98.81%
    Zofenopril is an angiotensin-converting enzyme (ACE) inhibitor with an IC50 of 81 μM.
    Zofenopril
  • HY-116023
    Moveltipril
    		Inhibitor 99.89%
    Moveltipril (Moveltipril calcium; MC-838) is a potent angiotensin converting enzyme (ACE) inhibitor.
    Moveltipril
  • HY-P3142
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
  • HY-163438
    BKIDC-1553
    		Inhibitor 99.65%
    BKIDC-1553 is an orally active antiglycolytic agent and a bumped kinase inhibitor derived compound with a predicted ~17 h half-life in human. BKIDC-1553 inhibits CYP2C8 and Angiotensin Converting Enzyme and can be used for cancer research.
    BKIDC-1553
  • HY-118472
    Benazeprilat
    		Inhibitor ≥99.0%
    Benazeprilat is an orally active and the active metabolite of benazepril, a carboxyl-containing ACE inhibitor with antihypertensive activity. Benazepril is a well-established antihypertensive agent, both in monoresearch and in combination with other classes of drugs including thiazide diuretics and calcium channel blockers. Benazepril is a first-line research in reducing various pathologies associated with CV risk and secondary end-organ damage.
    Benazeprilat
  • HY-109592
    Imidaprilate
    		Inhibitor
    Imidaprilate is an active metabolite of TA-6366, acts as a potent angiotensin converting enzyme (ACE) inhibitor, with an IC50 of 2.6 nM, and is used in the research of hypertensive disease.
    Imidaprilate
  • HY-P0318
    Hemorphin-7
    		Inhibitor
    Hemorphin-7 is a hemorphin peptide, an endogenous opioid peptide derived from the β-chain of hemoglobin. Hemorphin peptides exhibits antinociceptive and antihypertensive activities, activating opioid receptors and inhibiting angiotensin-converting enzyme (ACE).
    Hemorphin-7
  • HY-A0116A
    Trandolaprilate hydrate
    		Inhibitor
    Trandolaprilate hydrate is a potent angiotensin-converting enzyme (ACE) inhibitor. Trandolaprilate hydrate partially inhibits angiotensin-I-mediated c-fos induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity.
    Trandolaprilate hydrate
  • HY-B0279S
    Ramipril-d5
    		Inhibitor ≥99.0%
    Ramipril-d5 is the deuterium labeled Ramipril. Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC50 of 5 nM.
    Ramipril-d<sub>5</sub>
Cat. No. Product Name / Synonyms Species Source
Cat. No. Product Name / Synonyms Application Reactivity